Transcript | Ll_transcript_379701 |
---|---|
CDS coordinates | 1266-1862 (+) |
Peptide sequence | MLTPQQQLLFAQQNLASPSASDESRRLRMLLNNRSMSLNKDGLSNSVGDVVSNIGSPLQGGAPSFGRGDTDMLMKLKLAQLQHQQQLNTNPQQQQLQQPTLLNQQSQPSNHNIHQQDKVGGGGGNGTMDGSMPNSFRGNDQVSKNQMGRKRKQPVSSSGPANSTGTANTTGPSPSSAPSTPSTHTPGDVISMPALPHSG |
ORF Type | 3prime_partial |
Blastp | Transcriptional corepressor LEUNIG from Arabidopsis with 67.62% of identity |
---|---|
Blastx | Transcriptional corepressor LEUNIG from Arabidopsis with 68.36% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (AT4G32551) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019415191.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer