Transcript | Ll_transcript_379687 |
---|---|
CDS coordinates | 1326-1922 (+) |
Peptide sequence | MLTPQQQLMFAQQNLASPSASDESRRLRMLLNNRSMSLNKDGLSNSVGDVVSNIGSPLQGGAPSFGRGDTDMLMKLKLAQLQHQQQLNTNPQQQQLQQPTLLNQQSQPSNHNIHQQDKVGGGGGNGTMDGSMPNSFRGNDQVSKNQMGRKRKQPVSSSGPANSTGTANTTGPSPSSAPSTPSTHTPGDVISMPALPHSG |
ORF Type | 3prime_partial |
Blastp | Transcriptional corepressor LEUNIG from Arabidopsis with 68.1% of identity |
---|---|
Blastx | Transcriptional corepressor LEUNIG from Arabidopsis with 68.75% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (AT4G32551) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019415191.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer