Transcript | Ll_transcript_376998 |
---|---|
CDS coordinates | 206-745 (+) |
Peptide sequence | MKEWSCCKKRSHDFSLFLQIPGCKTGKHTSEKQVIAPVKKNTVPAPAAASLTNASSTDSCSRCRQGFFCSDHGSQGKLVEKPVNVAGDATSENKIFVAPKPPKKIVDINEPQICRNQGCGQTFKEKDNHDTACSYHPGPAVFHDRMKGWKCCDIHVKEFDEFITIPPCTKGWHNADPGS* |
ORF Type | complete |
Blastp | Cysteine and histidine-rich domain-containing protein RAR1 from Arabidopsis with 67.04% of identity |
---|---|
Blastx | Cysteine and histidine-rich domain-containing protein RAR1 from Arabidopsis with 67.74% of identity |
Eggnog | cysteine and histidine-rich domain (CHORD) containing 1(ENOG410XPV6) |
Kegg | Link to kegg annotations (AT5G51700) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019426573.1) |
Pfam | CHORD (PF04968.11) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer