Protein coding transcript 94687

• Transcript: Ll_transcript_376999
• CDS coordinates: 247-756 (+)
• Peptide sequence: MKSAHMLILVVGLTSAIFSVILVLYVFLYRMRKSKHESEKDIECLEQNKQEEDIVEKEDLMIFEGGEDLTICDILDAPGEVIGKSNYGTLYKALLQRSNKVRLLRFLRPLCTTKAEELDEMIQFLGRIRHPNLVPLLGFYTGPRFEKLLVHPFYRHGNLTQFIRGKCFS*
• ORF Type: complete

Annotations of Ll_transcript_376999

• Blastp: Probable leucine-rich repeat receptor-like protein kinase IMK3 from Arabidopsis with 42.06% of identity
• Blastx: Putative kinase-like protein TMKL1 from Arabidopsis with 35.67% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AT3G56100)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019449812.1)
• Pfam: Protein tyrosine kinase (PF07714.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;