Transcript | Ll_transcript_334599 |
---|---|
CDS coordinates | 260-745 (+) |
Peptide sequence | MFTAIIQSTATVMHLRLLRNAAVSSNYFFNHSRPLRNMKPIRVSMSSLPPSDPFEICVKASVTTPNRIGDCPFCQRVLLTLEEKHLPYDLKLVDLANKPEWFLKINPQGKVPVIKFHEKWVADSDVITQTLEEKYPSPPLTTPPEKTKVGSKIFPTIDNPT* |
ORF Type | complete |
Blastp | Glutathione S-transferase DHAR3, chloroplastic from Arabidopsis with 64.29% of identity |
---|---|
Blastx | Glutathione S-transferase DHAR3, chloroplastic from Arabidopsis with 64.29% of identity |
Eggnog | Chloride intracellular channel(ENOG4110FKA) |
Kegg | Link to kegg annotations (AT5G16710) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019459154.1) |
Pfam | Glutathione S-transferase, N-terminal domain (PF13417.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer