Transcript | Ll_transcript_515871 |
---|---|
CDS coordinates | 3-515 (+) |
Peptide sequence | LSGFHIIIIRIRKEEGEKEGVEGHPSAMYGGVEDVPQDKHESKVRMIGVIDENNEINDSPVEQVRLTVPITDDPTVPALTFRTWFLGLASCLLLSFVNQFFSFRTNPLYLSSVSAQIVTLPLGKLMAATLPTRRFQLPLTQWSFTLNPGTFSLKEHALITIFASSGSSGVY |
ORF Type | internal |
Blastp | Oligopeptide transporter 1 from Arabidopsis with 66.42% of identity |
---|---|
Blastx | Oligopeptide transporter 1 from Arabidopsis with 66.42% of identity |
Eggnog | oligo-peptide transporter(ENOG410XNZC) |
Kegg | Link to kegg annotations (AT5G55930) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019460501.1) |
Pfam | OPT oligopeptide transporter protein (PF03169.14) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer