Protein coding transcript 94881

• Transcript: Ll_transcript_515871
• CDS coordinates: 3-515 (+)
• Peptide sequence: LSGFHIIIIRIRKEEGEKEGVEGHPSAMYGGVEDVPQDKHESKVRMIGVIDENNEINDSPVEQVRLTVPITDDPTVPALTFRTWFLGLASCLLLSFVNQFFSFRTNPLYLSSVSAQIVTLPLGKLMAATLPTRRFQLPLTQWSFTLNPGTFSLKEHALITIFASSGSSGVY
• ORF Type: internal

Annotations of Ll_transcript_515871

• Blastp: Oligopeptide transporter 1 from Arabidopsis with 66.42% of identity
• Blastx: Oligopeptide transporter 1 from Arabidopsis with 66.42% of identity
• Eggnog: oligo-peptide transporter(ENOG410XNZC)
• Kegg: Link to kegg annotations (AT5G55930)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019460501.1)
• Pfam: OPT oligopeptide transporter protein (PF03169.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;