Protein coding transcript 94921

• Transcript: Ll_transcript_515006
• CDS coordinates: 4240-5163 (+)
• Peptide sequence: MLAGLFVCVVRKEEDSMIIRSPEPEVKILVDRDPIKTSFEEWAKPGHFSRTIAKGPDTTTWIWNLHADAHDFDSHTSDLEEISRKVFSAHFGQLSIIFLWLSGMYFHGARFSNYEAWLSDPTHIGPSAQVVWPIVGQEILNGDVGGGFRGIQITSGFFQIWRASGITSELQLYCTAIGALVFAALMLFAGWFHYHKAAPKLAWFQDVESMLNHHLAGLLGLGSLSWAGHQVHVSLPINQFLNAGVDPKEIPLPHEFILNRDLLAQLYPSFAEGATPFFTLNWSKYAEFLTFRGGLDPVTGGLWLTDIA
• ORF Type: 3prime_partial

Annotations of Ll_transcript_515006

• Blastp: Photosystem I P700 chlorophyll a apoprotein A1 from Arabis with 99.66% of identity
• Blastx: Photosystem I P700 chlorophyll a apoprotein A1 from Olimarabidopsis with 99.66% of identity
• Eggnog: -
• Kegg: -
• CantataDB: Link to cantataDB annotations (CNT0002248)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020981516.1)
• Pfam: Photosystem I psaA/psaB protein (PF00223.18)
• Rfam: tRNA (RF00005)
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;