Transcript | Ll_transcript_515041 |
---|---|
CDS coordinates | 1252-1626 (+) |
Peptide sequence | MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRDGMSAQSEGNYAEALQNYYEAMRLEIDPYDRSYILYNIGLIHTSNGEHTKALEYYFRALERNPFLPQAFNNMAVICHYRGEQAIR |
ORF Type | 3prime_partial |
Blastp | - |
---|---|
Blastx | Photosystem I assembly protein Ycf3 from Oenothera with 100% of identity |
Eggnog | - |
Kegg | - |
CantataDB | Link to cantataDB annotations (CNT0002248) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (YP_009027263.1) |
Pfam | - |
Rfam | tRNA (RF00005) |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer