| Transcript | Ll_transcript_515032 |
|---|---|
| CDS coordinates | 2610-2990 (+) |
| Peptide sequence | MSAQSEGNYAEALQNYYEAMRLEIDPYDRSYILYNIGLIHTSNGEHTKALEYYFRALERNPFLPQAFNNMAVICHYRGEQAIRQGYSEIAEAWFDQAAEYWKQAIALTPGNYIEAQNWLKITGRFE* |
| ORF Type | complete |
| Blastp | - |
|---|---|
| Blastx | Photosystem I assembly protein Ycf3 from Populus with 98.41% of identity |
| Eggnog | - |
| Kegg | Link to kegg annotations (Poptr_cp023) |
| CantataDB | Link to cantataDB annotations (CNT0002248) |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (YP_008963606.1) |
| Pfam | - |
| Rfam | tRNA (RF00005) |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer