Protein coding transcript 950

• Transcript: Ll_transcript_524468
• CDS coordinates: 353-1519 (+)
• Peptide sequence: MEVTTFLVLAIFVLCLHFITKTIKLRRHQSLNLPGGSLGWPIVGETFEFLRAMVDCNVVRFIKERMDKYDSRVFKTSLLGDPMVVFCGPSGNKFLFSNENKNVQVGWPTTVKKLLRSSLVNKVGDEAKITRRLLVSFLNPEALRKYLPKMDTIAQHHIDTHWQGKKEVVVHSTVKLYTFHLACCLFLSIEESIQLSNISSNFGKFLKGIIAFPINLPGTRFHAAMKAASVIQDEIKMIIKKRKVDLEERRVSPTQDLLSYLLATPDTNGRFLTEMEIIDNILLLLFAGHDTSRSVLSSIMKYLADLPQVYEQVLKEQLEISQGKEAGELLQWEDIQRMKYSWNVASEVMRLSPPVTGTYREAIKDFTYADYNIPKGWKVFFISLVKLC*
• ORF Type: complete

Annotations of Ll_transcript_524468

• Blastp: Beta-amyrin 28-oxidase from Panax with 48.05% of identity
• Blastx: Beta-amyrin 28-oxidase from Panax with 48.05% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AFO63032)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019464033.1)
• Pfam: Cytochrome P450 (PF00067.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;