Protein coding transcript 95066

• Transcript: Ll_transcript_514030
• CDS coordinates: 243-686 (+)
• Peptide sequence: MGKDLSDDQISSMKEAFTLFDSDGDGKIAPSELGILMRSLGGNPTQAQLKAIVAEENLTAPFDFPRFLDLMSKHMKLEPFDRQLRDAFKVLDKESTGFVSVTELRHILTSIGEKLEPAEFDEWIREIDVGSDGKIRYEDFIARMVAK*
• ORF Type: complete

Annotations of Ll_transcript_514030

• Blastp: Probable calcium-binding protein CML13 from Arabidopsis with 86.49% of identity
• Blastx: Probable calcium-binding protein CML13 from Arabidopsis with 86.49% of identity
• Eggnog: Calcium-binding protein(COG5126)
• Kegg: Link to kegg annotations (AT1G12310)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019445084.1)
• Pfam: EF hand (PF00036.31)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;