Protein coding transcript 95127

• Transcript: Ll_transcript_514572
• CDS coordinates: 242-961 (+)
• Peptide sequence: MSNPHAPFSKALLCNAGAGAAAGVIAASFVCPLDVIKTRLQVNGAPQLPNATVKGSLIVGSLEQIVQREGLRGMYRGLAPTVLALLPNWAVYFTIYEQIKSLLSSSDESCYLSIGANVVAASGAGVATTFATNPLWVVKTRLQTQGIRPGVVPYKSTLSALRRISREEGIRGLYSGLVPALVGISHVAIQFPTYEKIKFYLAKKDDKAMEELGACEVAIASSVSKFFASTLTYPHEVLC*
• ORF Type: complete

Annotations of Ll_transcript_514572

• Blastp: Nicotinamide adenine dinucleotide transporter 1, chloroplastic from Arabidopsis with 74.26% of identity
• Blastx: Nicotinamide adenine dinucleotide transporter 1, chloroplastic from Arabidopsis with 74.26% of identity
• Eggnog: solute carrier family 25 (pyrimidine nucleotide carrier(ENOG410XS20)
• Kegg: Link to kegg annotations (AT2G47490)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019451378.1)
• Pfam: Mitochondrial carrier protein (PF00153.26)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;