Transcript | Ll_transcript_515641 |
---|---|
CDS coordinates | 1-414 (+) |
Peptide sequence | KLYDFLQSPEDLERLYCEIHLLKTLKHKNIMKFYTSWVDTANRNINFVTEMFTSGTIRQFRLKHKRVHIRAVKHWCRQILEGLLYLHSHDPLVIHRDLKCDNIFMNGNQGEVKIGDLGLAAILRKSHADHCVGMSFP* |
ORF Type | 5prime_partial |
Blastp | Serine/threonine-protein kinase WNK1 from Arabidopsis with 45.16% of identity |
---|---|
Blastx | Serine/threonine-protein kinase WNK1 from Arabidopsis with 48.13% of identity |
Eggnog | WNK lysine deficient protein kinase(ENOG410XQWZ) |
Kegg | Link to kegg annotations (AT3G04910) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019428384.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer