Protein coding transcript 952

• Transcript: Ll_transcript_524436
• CDS coordinates: 2-439 (+)
• Peptide sequence: IVAGGGGSGGDGDNKKNVSPFAAQVIRVMELLDTSLEGKAKLYKDIALSNFFMMNNGRYILQKIKGSSEMAQLMGDSWCRKRSSELRTYHKIYQRETWNRVVACLTHEKLNVNGKVQKPVLKERFKSFNALFDEIHRTQSTWVVKE
• ORF Type: internal

Annotations of Ll_transcript_524436

• Blastp: Exocyst complex component EXO70B2 from Arabidopsis with 40% of identity
• Blastx: Exocyst complex component EXO70B2 from Arabidopsis with 39.23% of identity
• Eggnog: exocyst complex(ENOG410YIGI)
• Kegg: Link to kegg annotations (AT1G07000)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019429664.1)
• Pfam: Exo70 exocyst complex subunit (PF03081.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;