Transcript | Ll_transcript_334607 |
---|---|
CDS coordinates | 134-784 (+) |
Peptide sequence | MRIEGASNSDSISQCDSTVVVLNVYDLNPINNYMYCFGVGIYHSGIQVHGREYGFGAHDFPVSGVFEVEPRTCPGFIYRSSFTLGHTNMSSSEFRTFIEKMACEYHGDTYHLISKNCNHFADDLSLRLTGKQIPGWVNRLAKLGALCSCLLPESLQVTRVKRLPEYHEYSEDESAESHSTVTAEEGTEFEELEKLILSLSCRTGSDVIFVKDAHVK* |
ORF Type | complete |
Blastp | DeSI-like protein At4g17486 from Arabidopsis with 62.21% of identity |
---|---|
Blastx | DeSI-like protein At4g17486 from Arabidopsis with 59.77% of identity |
Eggnog | Desumoylating isopeptidase(ENOG4111H3Z) |
Kegg | Link to kegg annotations (AT4G17486) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019452249.1) |
Pfam | PPPDE putative peptidase domain (PF05903.13) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer