Transcript | Ll_transcript_516640 |
---|---|
CDS coordinates | 1446-2489 (+) |
Peptide sequence | MEKGLVHTKFLFSLLRTAMILRVSHSCMSNLEKRIGMQLDQATLDDLLIPTFSYSMETLYNIDCVQRILDHFLTMDQVTGAASPCSIDDDPLIGSPSLTPITMVAKLIDGFLAEVAPDVNLKFPKFEALAAAVPEYARPLDDGLYRALDIYLKSHPWLVESEREQLCRLMDCQKLSLEACTHAAQNERLPVRIIVQVLFFEQLQLRTSIAGCFLVSDNLDGSRQLRSGLIGNNEGGWASAVKENQVLKVGMDNMRLRVSDLEKECSNMRHEIEKLDRAKGSSKWAAVSKKLGFKIKSQMCSAEEGSVSNQKNSGNSKIEKLKDRHIVKQKKNSSISDKESVSSIVFS* |
ORF Type | complete |
Blastp | BTB/POZ domain-containing protein At1g30440 from Arabidopsis with 69.04% of identity |
---|---|
Blastx | BTB/POZ domain-containing protein At5g03250 from Arabidopsis with 54.55% of identity |
Eggnog | BTB POZ domain-containing protein(ENOG410ZHWZ) |
Kegg | Link to kegg annotations (AT1G30440) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019415117.1) |
Pfam | NPH3 family (PF03000.13) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer