Transcript | Ll_transcript_515128 |
---|---|
CDS coordinates | 2105-2494 (+) |
Peptide sequence | MPGQWEFQVGPSVGISAGDEIWAARYILARITEIAGVIVSFDPKPIPGDWNGAGAHANYSTKSMRKDGGYEVIKKAIKKLELKHKEHIAAYGEGNERRLTGKHETADINKFVWVNLIVALASTFVLGAQ* |
ORF Type | complete |
Blastp | Glutamine synthetase nodule isozyme from Medicago with 90.27% of identity |
---|---|
Blastx | Glutamine synthetase cytosolic isozyme 1 from Soja with 90.85% of identity |
Eggnog | - |
Kegg | - |
CantataDB | Link to cantataDB annotations (CNT0002361) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019430470.1) |
Pfam | Glutamine synthetase, catalytic domain (PF00120.23) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer