Protein coding transcript 95304

• Transcript: Ll_transcript_515129
• CDS coordinates: 2105-2596 (+)
• Peptide sequence: MPGQWEFQVGPSVGISAGDEIWAARYLLERITEIAGVVVSFDPKPIPGDWNGAGAHTNYSTKSMRNDGGYKIIEKAIEKLGLKHKEHIAAYGEGNERRLTGKHETASIEKFSWGVANRGASVRVGRDTEKEGKGYFEDRRPASNMDPYVVTSLIAETTILWKP*
• ORF Type: complete

Annotations of Ll_transcript_515129

• Blastp: Glutamine synthetase nodule isozyme from Medicago with 92.02% of identity
• Blastx: Glutamine synthetase nodule isozyme from Medicago with 92.61% of identity
• Eggnog: -
• Kegg: -
• CantataDB: Link to cantataDB annotations (CNT0002361)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019436730.1)
• Pfam: Glutamine synthetase, catalytic domain (PF00120.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;