Protein coding transcript 95305

• Transcript: Ll_transcript_515134
• CDS coordinates: 1200-1592 (+)
• Peptide sequence: MPGQWEFQVGPSVGISAGDEIWAARYILARITEIAGVIVSFDPKPIPGDWNGAGAHANYSTKSMRKDGGYEVIKKAIKKLELKHKEHIAAYGEGNERRLTGKHETADINKFVWGVANRGASVRIGRDTEKE
• ORF Type: 3prime_partial

Annotations of Ll_transcript_515134

• Blastp: Glutamine synthetase nodule isozyme from Medicago with 90.08% of identity
• Blastx: Glutamine synthetase cytosolic isozyme 1 from Soja with 91.18% of identity
• Eggnog: -
• Kegg: -
• CantataDB: Link to cantataDB annotations (CNT0002361)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019430470.1)
• Pfam: Glutamine synthetase, catalytic domain (PF00120.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;