Transcript | Ll_transcript_515105 |
---|---|
CDS coordinates | 1-417 (+) |
Peptide sequence | NLDLGETSTEKIIAEYIWIGGSGLDIRSKARTLPRPVSDPSKLPKWNYDGSSTNQAPGKDSEVILYPQAIFRDPFRRGNNILVICDAYAPSGEPIPSNKRHNAAKIFSHPVVAAEEPWYAFANIQFWILIIFNHIHII* |
ORF Type | 5prime_partial |
Blastp | Glutamine synthetase nodule isozyme from Vigna with 85.12% of identity |
---|---|
Blastx | Glutamine synthetase nodule isozyme from Vigna with 85.12% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019430470.1) |
Pfam | Glutamine synthetase, beta-Grasp domain (PF03951.18) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer