Transcript | Ll_transcript_515109 |
---|---|
CDS coordinates | 3-389 (+) |
Peptide sequence | EIAGVVLSLDPKPIPGDWNGAGAHTNYSTKSMRNDGGYEVIKKAIEKLGKRHNEHIAAYGEGNERRLTGRHETADISTFFWGVANRGASIRVGRDTEKEGKGYFEDRRPASNMDPYVVTSMIAETTLL* |
ORF Type | 5prime_partial |
Blastp | Glutamine synthetase nodule isozyme from Lupinus with 100% of identity |
---|---|
Blastx | Glutamine synthetase nodule isozyme from Lupinus with 100% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019459255.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer