Protein coding transcript 95310

• Transcript: Ll_transcript_515110
• CDS coordinates: 1-720 (+)
• Peptide sequence: NLDLGETSTEKIIAEYIWIGGSGLDIRSKARTLPRPVSDPSKLPKWNYDGSSTNQAPGKDSEVILYPQAIFRDPFRRGNNILVICDAYAPSGEPIPSNKRHNAAKIFSHPVVAAEEPWYGIEQEYTLLQKDTNWPLGWPIGGYPGPQGPYYCGIGADKSYGRDIVDAHYKACIYAGINISGINAEVMPGQWEFQVGPSVGISAGDELWAARYILERITEIAGVIVSFDPKPIPGDWNGAG
• ORF Type: internal

Annotations of Ll_transcript_515110

• Blastp: Glutamine synthetase nodule isozyme from Medicago with 89.58% of identity
• Blastx: Glutamine synthetase nodule isozyme from Medicago with 89.58% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019430470.1)
• Pfam: Glutamine synthetase, beta-Grasp domain (PF03951.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;