Protein coding transcript 95323

• Transcript: Ll_transcript_515648
• CDS coordinates: 251-634 (+)
• Peptide sequence: MGELDRTPFAEALKKKYNEEEAVKRASELSSLWEGYLKDPDWHPFKTILVEGQEKQIINDEDKRLNGLKSEIGEGAYKAVVTTLRERKEYNASGQHIVPELWNYEQGRRATLKEGVQFLVEHTTIVD*
• ORF Type: complete

Annotations of Ll_transcript_515648

• Blastp: Factor of DNA methylation 4 from Arabidopsis with 52.5% of identity
• Blastx: Factor of DNA methylation 4 from Arabidopsis with 49.64% of identity
• Eggnog: XH XS domain-containing protein(ENOG4111EBT)
• Kegg: Link to kegg annotations (AT1G13790)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019418754.1)
• Pfam: XH domain (PF03469.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;