Protein coding transcript 95324

• Transcript: Ll_transcript_515652
• CDS coordinates: 3-761 (+)
• Peptide sequence: CTHKRPNSIIAFATFSSFNLRPFSSSNNSLQMEKQKADEYLLKLAEDQKKQIEKLNAKIIELEKQLDVKQEDLIEKEEALQHYEDLNDILIIKERQYFDELHGARSELLNFIKDKPRRGKFGVKRMGELDRTPFAEALKKKYNEEEAVKRASELSSLWEGYLKDPDWHPFKTILVEGQEKQIINDEDKRLNGLKSEIGEGAYKAVVTTLRERKEYNASGQHIVPELWNYEQGRRATLKEGVQFLVEHTTIVD*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_515652

• Blastp: Protein INVOLVED IN DE NOVO 2 from Arabidopsis with 40.59% of identity
• Blastx: Protein INVOLVED IN DE NOVO 2 from Arabidopsis with 40.59% of identity
• Eggnog: XH XS domain-containing protein(ENOG410YGHF)
• Kegg: Link to kegg annotations (AT3G48670)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019418754.1)
• Pfam: XH domain (PF03469.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;