Protein coding transcript 95389

• Transcript: Ll_transcript_516689
• CDS coordinates: 1057-1680 (+)
• Peptide sequence: MLSALFFLQFVSVMSPPLLVTDEEGQSKVSSMVASASSQSLDCFSQNGVELKERNYMGLSDCSSVDSSSPTVPSFSDEKKGNLNLKATELSLGLPGSQSPEWNTDLYSLSSAKLDEKLLFPLLPMKDEICLASQKTVVSGNKRGFADTLDGFPQGKFSGNTGMGLMLSPRPSGAQLTTVKEVQSNVLRERPCAANGASISGSAPASK*
• ORF Type: complete

Annotations of Ll_transcript_516689

• Blastp: Auxin-responsive protein IAA9 from Arabidopsis with 53.45% of identity
• Blastx: Auxin-responsive protein IAA9 from Arabidopsis with 54.79% of identity
• Eggnog: auxin-responsive protein(ENOG4111VTJ)
• Kegg: Link to kegg annotations (AT5G65670)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019445333.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;