Transcript | Ll_transcript_516691 |
---|---|
CDS coordinates | 253-837 (+) |
Peptide sequence | MSPPLLVTEEEGQSKVSSAVASASLQSLDSFSQDAIELKERNYLGLSDCSSVDSSSPTVPSFSDEKKGNLNLKATELSLGLPGSQSPEWNTDLYSLSSAKLDEKLLFPLLPMKDEICLASQKTVVSGNKRGFADTLDGFPQGKFSGNTGMGLMLSPRPSGAQLTTVKEVQSNVLRERPCAANGASISGSAPASK* |
ORF Type | complete |
Blastp | Auxin-responsive protein IAA9 from Arabidopsis with 53.45% of identity |
---|---|
Blastx | Auxin-responsive protein IAA9 from Arabidopsis with 55.26% of identity |
Eggnog | auxin-responsive protein(ENOG4111VTJ) |
Kegg | Link to kegg annotations (AT5G65670) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019445333.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer