Transcript | Ll_transcript_516679 |
---|---|
CDS coordinates | 1057-1938 (+) |
Peptide sequence | MLSALFFLQFVSVMSPPLLVTDEEGQSKVSSMVASASSQSLDCFSQNGVELKERNYMGLSDCSSVDSSSPIVPSFSDEKKGILNLKATELRLGLPGSQSPERNPDLYSLSSAKLDEKPLFPLLPMKDGICLSSQKTVVSGNKRGFADTMDGFPQGKFTGNTGMGVMLSPRSSGVQPRAVKEIPNKVLQERPCAANGASISSTAPVSKAQVVGWPPIRSFRKNSMATTSKNNNEVDGKPGPAALFVKVSMDGAPYLRKVDLRNYTTYQELSCALEKMFSCFTLGQCGSHGAPGKE |
ORF Type | 3prime_partial |
Blastp | Auxin-responsive protein IAA9 from Arabidopsis with 58.03% of identity |
---|---|
Blastx | Auxin-responsive protein IAA9 from Arabidopsis with 58.27% of identity |
Eggnog | auxin-responsive protein(ENOG4111VTJ) |
Kegg | Link to kegg annotations (AT5G65670) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019423994.1) |
Pfam | AUX/IAA family (PF02309.15) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer