Protein coding transcript 954

• Transcript: Ll_transcript_524448
• CDS coordinates: 2-487 (+)
• Peptide sequence: AERKESKMDLESVKKSLEKGNETASLVDELPFRFLEPLITSSLKVDHIEPGRVVCSMKIPPRLIKHGNSLHGGATAALVDVVGCTAICSLGHPPLSTGVSVEINVSYMDAAYVDEEIEIEARALRVGKAVAVVSVEFKKKKTGEVLAQGRHTKYIPLASKM*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_524448

• Blastp: Acyl-coenzyme A thioesterase 13 from Pongo with 42.99% of identity
• Blastx: Acyl-coenzyme A thioesterase 13 from Pongo with 42.99% of identity
• Eggnog: thioesterase Superfamily protein(COG2050)
• Kegg: Link to kegg annotations (100173179)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019414341.1)
• Pfam: Thioesterase superfamily (PF03061.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;