Protein coding transcript 95460

• Transcript: Ll_transcript_515375
• CDS coordinates: 759-1448 (+)
• Peptide sequence: MEGFRVFVPDEWEASGMDATSFAAVDLKKCLEGLARHLFGAVEMRWVDTYFPFTNPSFELEIYFQEKWLEVLGCGVTEQEILNRNGKPNNVAWAFGLGLERLAMVLFDIPDIRLFWSNDERFTSQFSKGQLGVKFKPFSKFPPCFKDISFWINESFTENNLCEVVRGIAGDLVEEVQLIDNFTNKKGLTSHCYRIAYRSMERSLTDEEINDLQWKVREQVQSKLNVVIR*
• ORF Type: complete

Annotations of Ll_transcript_515375

• Blastp: Phenylalanine--tRNA ligase, chloroplastic/mitochondrial from Arabidopsis with 81.3% of identity
• Blastx: Phenylalanine--tRNA ligase, chloroplastic/mitochondrial from Arabidopsis with 82.97% of identity
• Eggnog: phenylalanyL-tRNA synthetase, alpha subunit(COG0016)
• Kegg: Link to kegg annotations (AT3G58140)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419283.1)
• Pfam: tRNA synthetases class II core domain (F) (PF01409.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;