Protein coding transcript 95536

• Transcript: Ll_transcript_516088
• CDS coordinates: 1252-2154 (+)
• Peptide sequence: MILKLMQGFFGTTSEVSEPDGLTKKGKTTKGTKRYMPQRNSVAYALLITLYRGTSNGNEFMRKQELIDAAEASGLSRVPILPEKGKGKPGHFGSSPREWYSGWSCMKTLVTKGLVVRSSCPAKYMLTQEGKEAACDCLKRSGMTESLEKSVSVEISSYIDKQNSLDKELEGHDSESEVMSPLTQQKKPMGVPLDSLERFTRMGYSKEQIVSAFTEVSRSYPNKDVSSLWPAVLCHLRGEQVYGPQPELQTNINNCHMISGSSDLIGNERRTVSSSRGGHVSNSRSLDIPSFPLRACSSNS*
• ORF Type: complete

Annotations of Ll_transcript_516088

• Blastp: Crossover junction endonuclease MUS81 from Arabidopsis with 51.55% of identity
• Blastx: Crossover junction endonuclease MUS81 from Arabidopsis with 51.52% of identity
• Eggnog: Excision repair cross-complementing rodent repair deficiency, complementation group 4(COG1948)
• Kegg: Link to kegg annotations (AT4G30870)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019427613.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;