Protein coding transcript 95547

• Transcript: Ll_transcript_516118
• CDS coordinates: 200-580 (+)
• Peptide sequence: MESPESSYESSPEGKRNHTSSPPISPTHDSEEKPTYVRFLVSNSAAGSVIGKGGSTVTDFQSQSGARIQLSRNHEFFPGTSDRIIMVSGTINEILSALELILSKLLSEVILMMLISLVTGRCLTCS*
• ORF Type: complete

Annotations of Ll_transcript_516118

• Blastp: Protein BTR1 from Arabidopsis with 65.14% of identity
• Blastx: Protein BTR1 from Arabidopsis with 74.65% of identity
• Eggnog: Neuro-oncological ventral antigen(ENOG410XRZD)
• Kegg: Link to kegg annotations (AT5G04430)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441001.1)
• Pfam: KH domain (PF00013.28)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;