Transcript | Ll_transcript_516118 |
---|---|
CDS coordinates | 200-580 (+) |
Peptide sequence | MESPESSYESSPEGKRNHTSSPPISPTHDSEEKPTYVRFLVSNSAAGSVIGKGGSTVTDFQSQSGARIQLSRNHEFFPGTSDRIIMVSGTINEILSALELILSKLLSEVILMMLISLVTGRCLTCS* |
ORF Type | complete |
Blastp | Protein BTR1 from Arabidopsis with 65.14% of identity |
---|---|
Blastx | Protein BTR1 from Arabidopsis with 74.65% of identity |
Eggnog | Neuro-oncological ventral antigen(ENOG410XRZD) |
Kegg | Link to kegg annotations (AT5G04430) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019441001.1) |
Pfam | KH domain (PF00013.28) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer