Transcript | Ll_transcript_516109 |
---|---|
CDS coordinates | 200-973 (+) |
Peptide sequence | MESPESSYESSPEGKRNHTSSPPISPTHDSEEKPTYVRFLVSNSAAGSVIGKGGSTVTDFQSQSGARIQLSRNHEFFPGTSDRIIMVSGTINEILSALELILSKLLSELHIEDGNDAEPKTKVRLIVPNGSCGGIIGKGGATVRSFIEDSQAGIKISPQDNNYYGLNDRLVTVTGTLDEQMRAIDLIISKLAEDPHYSQTMNSPFSYPGVYFSGYQGVPYTYVLPSVGPPAYNAVNYRANGAGGKFQSSKVLLIPLI* |
ORF Type | complete |
Blastp | Protein BTR1 from Arabidopsis with 61.2% of identity |
---|---|
Blastx | Protein BTR1 from Arabidopsis with 63.32% of identity |
Eggnog | Neuro-oncological ventral antigen(ENOG410XRZD) |
Kegg | Link to kegg annotations (AT5G04430) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019441001.1) |
Pfam | KH domain (PF00013.28) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer