Protein coding transcript 95556

• Transcript: Ll_transcript_516112
• CDS coordinates: 200-973 (+)
• Peptide sequence: MESPESSYESSPEGKRNHTSSPPISPTHDSEEKPTYVRFLVSNSAAGSVIGKGGSTVTDFQSQSGARIQLSRNHEFFPGTSDRIIMVSGTINEILSALELILSKLLSELHIEDGNDAEPKTKVRLIVPNGSCGGIIGKGGATVRSFIEDSQAGIKISPQDNNYYGLNDRLVTVTGTLDEQMRAIDLIISKLAEDPHYSQTMNSPFSYPGVYFSGYQGVPYTYVLPSVGPPAYNAVNYRANGAGGKFQSSKVLLIPLI*
• ORF Type: complete

Annotations of Ll_transcript_516112

• Blastp: Protein BTR1 from Arabidopsis with 61.2% of identity
• Blastx: Protein BTR1 from Arabidopsis with 63.32% of identity
• Eggnog: Neuro-oncological ventral antigen(ENOG410XRZD)
• Kegg: Link to kegg annotations (AT5G04430)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441001.1)
• Pfam: KH domain (PF00013.28)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;