Protein coding transcript 95558

• Transcript: Ll_transcript_516115
• CDS coordinates: 200-994 (+)
• Peptide sequence: MESPESSYESSPEGKRNHTSSPPISPTHDSEEKPTYVRFLVSNSAAGSVIGKGGSTVTDFQSQSGARIQLSRNHEFFPGTSDRIIMVSGTINEILSALELILSKLLSELHIEDGNDAEPKTKVRLIVPNGSCGGIIGKGGATVRSFIEDSQAGIKISPQDNNYFGLNDRLVTVTGTLDEQLHAVDLIVSKLSEDAHYSQSINSPMSYPGVSPSGYHGAPYVLPSGSTTAYNPSSHVTNGAGRKFENNKVFLIPVTESVNPSNIS*
• ORF Type: complete

Annotations of Ll_transcript_516115

• Blastp: Protein BTR1 from Arabidopsis with 58.47% of identity
• Blastx: Protein BTR1 from Arabidopsis with 60.35% of identity
• Eggnog: Neuro-oncological ventral antigen(ENOG410XRZD)
• Kegg: Link to kegg annotations (AT5G04430)
• CantataDB: Link to cantataDB annotations (CNT0000795)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461721.1)
• Pfam: KH domain (PF00013.28)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;