Transcript | Ll_transcript_334490 |
---|---|
CDS coordinates | 202-828 (+) |
Peptide sequence | MKILVTGASGYLGGRLCNSLLRQGYSVRVLVRSTSNLSALPPPSSSASLEIVYGDVTDYASLLCAFSGCSVVFHVAAIVEPWLPDPSRFFSVNVGGLKNVLEAVKETKTVEKLIYTSSFFALGPSDDGGVADENQVHHEKFFCTEYEKSKVAADKIALQAAADDGFSIVLLYPGVIYGPGKVTAGNVVARIVLFLPLHFFVVVFINAI* |
ORF Type | complete |
Blastp | Putative dihydroflavonol 4-reductase from Synechocystis with 35.57% of identity |
---|---|
Blastx | Putative dihydroflavonol 4-reductase from Synechocystis with 33.33% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (slr1706) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019433108.1) |
Pfam | RmlD substrate binding domain (PF04321.16) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer