Protein coding transcript 9560

• Transcript: Ll_transcript_334491
• CDS coordinates: 202-612 (+)
• Peptide sequence: MKILVTGASGYLGGRLCNSLLRQGYSVRVLVRSTSNLSALPPPSSSASLEIVYGDVTDYASLLCAFSGCSVVFHVAAIVEPWLPDPSRFFSVNVGGLKNVLEAVKETKTVEKLIYTSSFFALGPSDDGGVADENQV*
• ORF Type: complete

Annotations of Ll_transcript_334491

• Blastp: Putative dihydroflavonol 4-reductase from Synechocystis with 39.55% of identity
• Blastx: Putative dihydroflavonol 4-reductase from Synechocystis with 38.17% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (slr1706)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019433108.1)
• Pfam: RmlD substrate binding domain (PF04321.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;