Protein coding transcript 95621

• Transcript: Ll_transcript_515738
• CDS coordinates: 1-1227 (+)
• Peptide sequence: HTLKDRSKNMRIDYLKHKSVILKLVVITFFFGFALKLIFFHSLPQKTLLVMEHPFHEKTTNVTEQQNTLVSEHVPEIEDQLSYINTEKCDYLSGDWVPNPKGPLYSEDCNHIEPYQNCLKNGRPDREFLYWKWAPTNCDLPSFDPHKFLNAMRNKAWALIGDSITRNHVKSLMCMLSTVGQPIVLYEEKGFKSKTWHFPSYNFTLSVIWSPFLVEADIIEDINGVPNSEIELHLDKLSSKWKNQFMNFDYIILSCGKWFLRSAIYYENNTILGCHSCPKRNLIELEFTFAYRKAIKFVLNSMVSSNHKGMIFYRTFTPDHFENGEWSNGGTCKRTKPVKEGEMEIKYLNKMLRDIELKEVGNAVIEASRNGVNLRVVDFVPLSLLRPDGHPGPYREFHPFDKRDKNGEV
• ORF Type: internal

Annotations of Ll_transcript_515738

• Blastp: Protein trichome birefringence-like 23 from Arabidopsis with 51.67% of identity
• Blastx: Protein trichome birefringence-like 23 from Arabidopsis with 51.67% of identity
• Eggnog: expressed protein(ENOG410XSGA)
• Kegg: Link to kegg annotations (AT4G11090)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019423687.1)
• Pfam: PMR5 N terminal Domain (PF14416.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;