Protein coding transcript 95693

• Transcript: Ll_transcript_514003
• CDS coordinates: 994-1620 (+)
• Peptide sequence: MRHLEGAYALIFKSRHYPNELIACKRGSPLLLGVKEMRENQENGSAFEDNTFMSKDGHPKELFLSSDAHAVVEHTKKVLVIEDGEVVHLKDGGVSILKFENDKGEHVGPLSRVASVRRALSILEMEVEQINKGHYEHYMQKEIHEQPESLTTTMRGRLIRRGSSKSKSVLLGGLKDHLKTIRRSRRIVFIGCGTSYNAALAARPILEEL
• ORF Type: 3prime_partial

Annotations of Ll_transcript_514003

• Blastp: Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 from Bos with 43.35% of identity
• Blastx: Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 from Bos with 46.43% of identity
• Eggnog: Catalyzes the first step in hexosamine metabolism, converting fructose-6P into glucosamine-6P using glutamine as a nitrogen source (By similarity)(COG0449)
• Kegg: Link to kegg annotations (530101)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019431214.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;