Protein coding transcript 95695

• Transcript: Ll_transcript_514005
• CDS coordinates: 115-432 (+)
• Peptide sequence: MCGIFAYLNYKVKRERRYIIEVLFNGLRRLEYRGYDSAGIAIDSCSFPSVNADPNSISNSSHTPPPLVFRQEGNIESLVKSVHQGPQFQFPLLLYTITILLNQFW*
• ORF Type: complete

Annotations of Ll_transcript_514005

• Blastp: Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1 from Rattus with 44.05% of identity
• Blastx: Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 from Homo with 53.69% of identity
• Eggnog: Catalyzes the first step in hexosamine metabolism, converting fructose-6P into glucosamine-6P using glutamine as a nitrogen source (By similarity)(COG0449)
• Kegg: Link to kegg annotations (297417)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413935.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;