Transcript | Ll_transcript_514006 |
---|---|
CDS coordinates | 115-837 (+) |
Peptide sequence | MCGIFAYLNYKVKRERRYIIEVLFNGLRRLEYRGYDSAGIAIDSCSFPSVNADPNSISNSSHTPPPLVFRQEGNIESLVKSVHQEVADVELNLEESFLTHAGIAHTRWATHGEPAPRNSHPQSSGPGDDFLVVHNGVITNYEVLKETLVRHGFIFESETDTEVIPKLAKFVYDKANEAAGDQIVTFSQVVLEVMRHLEGAYALIFKSRHYPNELIACKRGSPLLLGVKVSGMQFNRDQVS* |
ORF Type | complete |
Blastp | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1 from Rattus with 49.56% of identity |
---|---|
Blastx | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1 from Rattus with 49.56% of identity |
Eggnog | Catalyzes the first step in hexosamine metabolism, converting fructose-6P into glucosamine-6P using glutamine as a nitrogen source (By similarity)(COG0449) |
Kegg | Link to kegg annotations (297417) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019413935.1) |
Pfam | Glutamine amidotransferase domain (PF13522.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer