Protein coding transcript 95697

• Transcript: Ll_transcript_514007
• CDS coordinates: 952-1578 (+)
• Peptide sequence: MRHLEGAYALIFKSRHYPNELIACKRGSPLLLGVKELRENQENGSAFEENKFLSKDGHPKELFLSSDAHAVVEHTKKVLVVEDGEVVHLKDGGVSILKFENDKGEHVGPLSRVASVRRALSILEMEVEQINKGHYEHYMQKEIHEQPESLTTTMRGRLIRRGSSKSKSVLLGGLKDHLKTIRRSRRIVFIGCGTSYNAALAARPILEEL
• ORF Type: 3prime_partial

Annotations of Ll_transcript_514007

• Blastp: Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 from Mus with 42.86% of identity
• Blastx: Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 from Bos with 46.43% of identity
• Eggnog: Catalyzes the first step in hexosamine metabolism, converting fructose-6P into glucosamine-6P using glutamine as a nitrogen source (By similarity)(COG0449)
• Kegg: Link to kegg annotations (14584)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413935.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;