Protein coding transcript 95704

• Transcript: Ll_transcript_516077
• CDS coordinates: 3-347 (+)
• Peptide sequence: AAMKGAKSKTETKRADPKLSVNKKGAGAAKPARKPAKGKAAIDPNKPKRPASAFFVFMEEFRKQFNKENPDNKAVSAVGKAAGAKWKTMSEAVRILMFISLKLCLDRRLISCWY*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_516077

• Blastp: HMG1/2-like protein from Soja with 84.62% of identity
• Blastx: HMG1/2-like protein from Soja with 61.94% of identity
• Eggnog: high mobility group(COG5648)
• Kegg: Link to kegg annotations (547975)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453835.1)
• Pfam: HMG-box domain (PF09011.9)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;