Transcript | Ll_transcript_516064 |
---|---|
CDS coordinates | 911-1402 (+) |
Peptide sequence | MILQCPMEILNYGRNFQLIAISNCHHDCVQRIHFAAQPLSHMDIQKVVCATTINQNVQRFLLITPCHPHSSETSNTSQSIHRNLRFTDFSAMVIFLIQPFNFIIIQFYKMQLNFLVCETMLRAIRFITEVAKAFTSSLSDESRGQSPHRPRFWFHRIHHIALH* |
ORF Type | complete |
Blastp | Transposon Ty3-I Gag-Pol polyprotein from Saccharomyces with 43.94% of identity |
---|---|
Blastx | Transposon Ty3-I Gag-Pol polyprotein from Saccharomyces with 43.94% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (YIL082W-A) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_014517438.1) |
Pfam | Retrotransposon gag protein (PF03732.16) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer