Transcript | Ll_transcript_516066 |
---|---|
CDS coordinates | 102-581 (+) |
Peptide sequence | MKGAKSKTETKRADPKLSVNKKGAGAAKPARKPAKGKAAIDPNKPKRPASAFFVFMEEFRKQFNKENPDNKAVSAVGKAAGAKWKTMSEADKAPYVAKAEKRKVEYEKSMRAYNKKQAEGPAAADEEESEKSISEVHDEDDGDDDGSDEDDDDDDDDDE* |
ORF Type | complete |
Blastp | HMG1/2-like protein from Soja with 84.13% of identity |
---|---|
Blastx | HMG1/2-like protein from Soja with 76.8% of identity |
Eggnog | high mobility group(COG5648) |
Kegg | Link to kegg annotations (547975) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019453835.1) |
Pfam | HMG-box domain (PF09011.9) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer