Protein coding transcript 95711

• Transcript: Ll_transcript_516071
• CDS coordinates: 3502-3993 (+)
• Peptide sequence: MILQCPMEILNYGRNFQLIAISNCHHDCVQRIHFAAQPLSHMDIQKVVCATTINQNVQRFLLITPCHPHSSETSNTSQSIHRNLRFTDFSAMVIFLIQPFNFIIIQFYKMQLNFLVCETMLRAIRFITEVAKAFTSSLSDESRGQSPHRPRFWFHRIHHIALH*
• ORF Type: complete

Annotations of Ll_transcript_516071

• Blastp: Transposon Ty3-G Gag-Pol polyprotein from Saccharomyces with 35.07% of identity
• Blastx: Transposon Ty3-G Gag-Pol polyprotein from Saccharomyces with 35.07% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (YGR109W-B)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_014490494.1)
• Pfam: Retrotransposon gag protein (PF03732.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;