Protein coding transcript 95773

• Transcript: Ll_transcript_516253
• CDS coordinates: 67-528 (+)
• Peptide sequence: MTIGFMEVLLVKAKGLHETDIFARMDPYVLLQYKGQERKSSVLHEAGSNPVWNEKIVFRVEYPGSGDPYKLYLKIMDRDVFSADDFVGQASIYVKDLLAEGAEKGSAKLHPCKYSVVGANQSYCGEIEIGITFTRKEEEYGDYDFGGWKESEY*
• ORF Type: complete

Annotations of Ll_transcript_516253

• Blastp: Elicitor-responsive protein 1 from Oryza sativa with 43.14% of identity
• Blastx: Elicitor-responsive protein 1 from Oryza sativa with 43.14% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (4327497)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019454840.1)
• Pfam: C2 domain (PF00168.29)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;