Protein coding transcript 95789

• Transcript: Ll_transcript_515363
• CDS coordinates: 3-491 (+)
• Peptide sequence: GKEIVDLCLDRIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSLLEHTDVSILLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYA
• ORF Type: internal

Annotations of Ll_transcript_515363

• Blastp: Tubulin alpha-2 chain from Gossypium with 98.77% of identity
• Blastx: Tubulin alpha-2 chain from Gossypium with 98.77% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019427961.1)
• Pfam: Tubulin/FtsZ family, GTPase domain (PF00091.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;