Protein coding transcript 9581

• Transcript: Ll_transcript_334704
• CDS coordinates: 224-850 (+)
• Peptide sequence: MSTDRIKPSDVGLEHEAQVVRNWSGSMLEPNESPQSLPTIKYLHLHECDSFSIGIFCMPPSSIIPLHNHPGMTVLSKLLYGSLYVKSYDWIDAPGPADPSEARPAKLVKDREMTAPSPTTVLYPTSGGNIHCFRARTPCAIFDILAPPYSSEHGRHCTYFRRSQRKDLPGNLELDGVPVSDVTWLEEFQPPDDFVIRRGLYRGPVIRA*
• ORF Type: complete

Annotations of Ll_transcript_334704

• Blastp: Plant cysteine oxidase 4 from Arabidopsis with 75.36% of identity
• Blastx: Plant cysteine oxidase 4 from Arabidopsis with 75.36% of identity
• Eggnog: 2-aminoethanethiol(ENOG4111Y3H)
• Kegg: Link to kegg annotations (AT2G42670)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019449695.1)
• Pfam: PCO_ADO (PF07847.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;