Protein coding transcript 95911

• Transcript: Ll_transcript_514308
• CDS coordinates: 1196-2161 (+)
• Peptide sequence: MAMTSEIQSQLSKRNAITIGGNLAVDGNEGGGAATALFRHQISQVSSIEFVASSGLRSLIGVQASRNLSSHSAATMGIAMSLRDGSLNLSNLWTRQLSETASGHIQLALGPQSSIAVGWQKKDERRSASGEVKIGTGSFDTSVRYTHRFSPNSLGCIVGRFGSSSLELEVGGGRKISKFSTVRWMYTVGIQGIFWKFELYRGGQKLIIPILLTRHLNPVFATGALFVPGSLYFVLKNFFIKPYYLRRNKQKALEKDENSSTQVWVINICFYSQCVIFLVCNDYPLNAECSFVCCVMAITIHILFNNLKSASCPCMSHYMLA*
• ORF Type: complete

Annotations of Ll_transcript_514308

• Blastp: Chaperone protein dnaJ 13 from Arabidopsis with 64.26% of identity
• Blastx: Chaperone protein dnaJ 13 from Arabidopsis with 64.26% of identity
• Eggnog: ATP binding to DnaK triggers the release of the substrate protein, thus completing the reaction cycle. Several rounds of ATP-dependent interactions between DnaJ, DnaK and GrpE are required for fully efficient folding. Also involved, together with DnaK and GrpE, in the DNA replication of plasmids through activation of initiation proteins (By similarity)(COG0484)
• Kegg: Link to kegg annotations (AT2G35720)
• CantataDB: Link to cantataDB annotations (CNT0000177)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019445060.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;