Protein coding transcript 95923

• Transcript: Ll_transcript_515944
• CDS coordinates: 1794-2786 (+)
• Peptide sequence: MPSIILSYWFQIVRESDGNAETSKQPINIPPPRPKRKPLHPYPRKSVNSPKEHFIKSESGISPPSNLLIAEKITQSPTSVLSAFGSDALGESFLDQTNRCVSPNSCTTDIHSLSLSPVEMENECMISNSSEEEAKGSLASVPLSTSSKLLSSVKSEFSSKETDCFKEVAETPRVTCIKLFGKTVSMVGNQKSMNVDEEENNNSISNNSSEVGNVEHQNLGQACSSEQVDIHLSLRLCNSNCHRNPDGVKVTGEEGNSCTGSNAESVGGMENQCKILDSDDSQYKKSHHVEGKVSQRGFAPYKRCSSERDAELECIRSIKGRPSASGFRLG*
• ORF Type: complete

Annotations of Ll_transcript_515944

• Blastp: Protein REVEILLE 7 from Arabidopsis with 33.55% of identity
• Blastx: Protein REVEILLE 1 from Arabidopsis with 54.9% of identity
• Eggnog: Transcription factor(COG5269)
• Kegg: Link to kegg annotations (AT1G18330)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019431386.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;